Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2881414..2882016 | Replicon | chromosome |
| Accession | NZ_OW848785 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | LQ117_RS13910 | Protein ID | WP_000897302.1 |
| Coordinates | 2881414..2881725 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ117_RS13915 | Protein ID | WP_000356397.1 |
| Coordinates | 2881726..2882016 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ117_RS13885 (2877328) | 2877328..2877927 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| LQ117_RS13890 (2877921) | 2877921..2878793 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| LQ117_RS13895 (2878790) | 2878790..2879227 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| LQ117_RS13900 (2879272) | 2879272..2880213 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| LQ117_RS13905 (2880277) | 2880277..2881185 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| LQ117_RS13910 (2881414) | 2881414..2881725 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| LQ117_RS13915 (2881726) | 2881726..2882016 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| LQ117_RS13920 (2882375) | 2882375..2882653 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| LQ117_RS13925 (2883050) | 2883050..2883268 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| LQ117_RS13930 (2883453) | 2883453..2884193 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| LQ117_RS13935 (2884218) | 2884218..2885066 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| LQ117_RS13940 (2885356) | 2885356..2885598 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| LQ117_RS13945 (2885780) | 2885780..2886709 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T295527 WP_000897302.1 NZ_OW848785:2881414-2881725 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|