Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2072188..2072987 | Replicon | chromosome |
Accession | NZ_OW848785 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | LQ117_RS09955 | Protein ID | WP_000347251.1 |
Coordinates | 2072523..2072987 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | LQ117_RS09950 | Protein ID | WP_001296435.1 |
Coordinates | 2072188..2072523 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ117_RS09935 (2067973) | 2067973..2068743 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
LQ117_RS09940 (2068759) | 2068759..2070093 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
LQ117_RS09945 (2070468) | 2070468..2072039 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
LQ117_RS09950 (2072188) | 2072188..2072523 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LQ117_RS09955 (2072523) | 2072523..2072987 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LQ117_RS09960 (2073042) | 2073042..2073851 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
LQ117_RS09965 (2074100) | 2074100..2075380 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LQ117_RS09970 (2075403) | 2075403..2075876 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LQ117_RS09975 (2075887) | 2075887..2076666 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LQ117_RS09980 (2076656) | 2076656..2077534 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LQ117_RS09985 (2077552) | 2077552..2077986 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T295525 WP_000347251.1 NZ_OW848785:2072523-2072987 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |