Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
| Location | 1076620..1077132 | Replicon | chromosome |
| Accession | NZ_OW724079 | ||
| Organism | Streptococcus sp. Marseille-Q3533 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | NBW44_RS05375 | Protein ID | WP_250307520.1 |
| Coordinates | 1076620..1076874 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | NBW44_RS05380 | Protein ID | WP_250307521.1 |
| Coordinates | 1076878..1077132 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBW44_RS05360 | 1073696..1074010 | - | 315 | WP_006153745.1 | DNA-directed RNA polymerase subunit omega | - |
| NBW44_RS05365 | 1074035..1074661 | - | 627 | WP_250307518.1 | guanylate kinase | - |
| NBW44_RS05370 | 1074798..1076411 | - | 1614 | WP_250307519.1 | ribonuclease Y | - |
| NBW44_RS05375 | 1076620..1076874 | - | 255 | WP_250307520.1 | Txe/YoeB family addiction module toxin | Toxin |
| NBW44_RS05380 | 1076878..1077132 | - | 255 | WP_250307521.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NBW44_RS05385 | 1077266..1078363 | - | 1098 | WP_250307522.1 | nucleotidyltransferase | - |
| NBW44_RS05390 | 1078373..1079113 | - | 741 | WP_284346465.1 | class I SAM-dependent methyltransferase | - |
| NBW44_RS05395 | 1079473..1079826 | - | 354 | WP_250307523.1 | ribosome silencing factor | - |
| NBW44_RS05400 | 1079827..1080420 | - | 594 | WP_250307524.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
| NBW44_RS05405 | 1080420..1081049 | - | 630 | WP_036759262.1 | nicotinate-nucleotide adenylyltransferase | - |
| NBW44_RS05410 | 1081100..1081411 | - | 312 | WP_250307525.1 | ribosome assembly RNA-binding protein YhbY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10115.55 Da Isoelectric Point: 7.9716
>T295514 WP_250307520.1 NZ_OW724079:c1076874-1076620 [Streptococcus sp. Marseille-Q3533]
MLLKFTEDAWADYCYWQNQDKKTLKRINKLIKDIQRDPFTGIGKPEPLKYDYQGAWSRRIDAENRIIYMMDGDSVAFLSF
KDHY
MLLKFTEDAWADYCYWQNQDKKTLKRINKLIKDIQRDPFTGIGKPEPLKYDYQGAWSRRIDAENRIIYMMDGDSVAFLSF
KDHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|