Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 2996539..2997293 Replicon chromosome
Accession NZ_OW706512
Organism Salmonella enterica subsp. enterica serovar Typhi strain BRD948

Toxin (Protein)


Gene name higB Uniprot ID Q8Z2U0
Locus tag NBW89_RS15160 Protein ID WP_000558160.1
Coordinates 2996539..2996850 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NBW89_RS15165 Protein ID WP_001259009.1
Coordinates 2996847..2997293 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBW89_RS15130 2992205..2993107 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
NBW89_RS15135 2993104..2993739 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
NBW89_RS15140 2993736..2994665 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
NBW89_RS15145 2994703..2995077 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin -
NBW89_RS15150 2995077..2995319 - 243 WP_001523745.1 CopG family transcriptional regulator -
NBW89_RS15155 2995524..2996453 + 930 WP_001162859.1 alpha/beta hydrolase -
NBW89_RS15160 2996539..2996850 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin Toxin
NBW89_RS15165 2996847..2997293 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
NBW89_RS15170 2997308..2998249 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NBW89_RS15175 2998294..2998731 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
NBW89_RS15180 2998728..2999600 - 873 WP_000921423.1 virulence factor BrkB family protein -
NBW89_RS15185 2999594..3000193 - 600 WP_000965695.1 glucose-1-phosphatase -
NBW89_RS15190 3000384..3001187 - 804 WP_000059689.1 DeoR family transcriptional regulator -
NBW89_RS15195 3001221..3002117 - 897 WP_001520529.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12449.38 Da        Isoelectric Point: 8.4020

>T295478 WP_000558160.1 NZ_OW706512:2996539-2996850 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT295478 WP_001259009.1 NZ_OW706512:2996847-2997293 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A714FUZ5

Antitoxin

Source ID Structure

References