Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1401135..1401889 Replicon chromosome
Accession NZ_OW704627
Organism Salmonella enterica subsp. enterica serovar Typhi strain BRD948

Toxin (Protein)


Gene name higB Uniprot ID Q8Z2U0
Locus tag NBW95_RS06850 Protein ID WP_000558160.1
Coordinates 1401578..1401889 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NBW95_RS06845 Protein ID WP_001259009.1
Coordinates 1401135..1401581 (-) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBW95_RS06815 1396311..1397207 + 897 WP_001520529.1 sugar kinase -
NBW95_RS06820 1397241..1398044 + 804 WP_000059689.1 DeoR family transcriptional regulator -
NBW95_RS06825 1398235..1398834 + 600 WP_000965695.1 glucose-1-phosphatase -
NBW95_RS06830 1398828..1399700 + 873 WP_000921423.1 virulence factor BrkB family protein -
NBW95_RS06835 1399697..1400134 + 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
NBW95_RS06840 1400179..1401120 + 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NBW95_RS06845 1401135..1401581 - 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
NBW95_RS06850 1401578..1401889 - 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin Toxin
NBW95_RS06855 1401975..1402904 - 930 WP_001162859.1 alpha/beta hydrolase -
NBW95_RS06860 1403109..1403351 + 243 WP_001523745.1 CopG family transcriptional regulator -
NBW95_RS06865 1403351..1403725 + 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin -
NBW95_RS06870 1403763..1404692 - 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
NBW95_RS06875 1404689..1405324 - 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
NBW95_RS06880 1405321..1406223 - 903 WP_000331359.1 formate dehydrogenase subunit beta -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12449.38 Da        Isoelectric Point: 8.4020

>T295458 WP_000558160.1 NZ_OW704627:c1401889-1401578 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT295458 WP_001259009.1 NZ_OW704627:c1401581-1401135 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A714FUZ5

Antitoxin

Source ID Structure

References