Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 152071..152825 | Replicon | chromosome |
| Accession | NZ_OW704291 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain BRD948 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q8Z2U0 |
| Locus tag | NBX00_RS00715 | Protein ID | WP_000558160.1 |
| Coordinates | 152071..152382 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NBX00_RS00720 | Protein ID | WP_001259009.1 |
| Coordinates | 152379..152825 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBX00_RS00685 | 147737..148639 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
| NBX00_RS00690 | 148636..149271 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NBX00_RS00695 | 149268..150197 | + | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
| NBX00_RS00700 | 150235..150609 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| NBX00_RS00705 | 150609..150851 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| NBX00_RS00710 | 151056..151985 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
| NBX00_RS00715 | 152071..152382 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NBX00_RS00720 | 152379..152825 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NBX00_RS00725 | 152840..153781 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NBX00_RS00730 | 153826..154263 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
| NBX00_RS00735 | 154260..155132 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NBX00_RS00740 | 155126..155725 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NBX00_RS00745 | 155916..156719 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| NBX00_RS00750 | 156753..157649 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12449.38 Da Isoelectric Point: 8.4020
>T295440 WP_000558160.1 NZ_OW704291:152071-152382 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT295440 WP_001259009.1 NZ_OW704291:152379-152825 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|