Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 22331..22927 Replicon plasmid RHOApg
Accession NZ_OW485608
Organism Rhodovastum atsumiense strain G2-11

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag NBY65_RS33420 Protein ID WP_150043329.1
Coordinates 22646..22927 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NBY65_RS33415 Protein ID WP_150043328.1
Coordinates 22331..22633 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY65_RS33375 (RHOA_PG0025) 17337..17624 - 288 WP_150043315.1 hypothetical protein -
NBY65_RS33380 (RHOA_PG0027) 17767..18216 - 450 WP_150043316.1 hypothetical protein -
NBY65_RS33385 18383..18568 + 186 WP_150043318.1 hypothetical protein -
NBY65_RS33390 (RHOA_PG0030) 18669..19133 - 465 WP_150043320.1 hypothetical protein -
NBY65_RS33395 (RHOA_PG0031) 19123..20283 - 1161 WP_203330637.1 ParB N-terminal domain-containing protein -
NBY65_RS33400 (RHOA_PG0033) 20650..21144 + 495 WP_150043324.1 helix-turn-helix transcriptional regulator -
NBY65_RS33405 21623..21781 - 159 WP_162530760.1 hypothetical protein -
NBY65_RS33410 (RHOA_PG0038) 21878..22171 + 294 WP_150043326.1 Arc family DNA-binding protein -
NBY65_RS33415 (RHOA_PG0039) 22331..22633 - 303 WP_150043328.1 HigA family addiction module antitoxin Antitoxin
NBY65_RS33420 (RHOA_PG0040) 22646..22927 - 282 WP_150043329.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NBY65_RS33425 23006..23536 - 531 WP_150043331.1 hypothetical protein -
NBY65_RS33430 (RHOA_PG0042) 23727..24104 + 378 WP_150043333.1 hypothetical protein -
NBY65_RS33435 (RHOA_PG0043) 24122..24379 + 258 WP_150043335.1 hypothetical protein -
NBY65_RS33440 (RHOA_PG0045) 24381..24908 + 528 WP_150043337.1 hypothetical protein -
NBY65_RS33445 (RHOA_PG0046) 24910..25284 + 375 WP_150043339.1 hypothetical protein -
NBY65_RS33450 (RHOA_PG0047) 25335..26171 + 837 WP_150043341.1 hypothetical protein -
NBY65_RS33455 (RHOA_PG0048) 26412..26681 + 270 WP_150043343.1 hypothetical protein -
NBY65_RS33460 (RHOA_PG0049) 26683..26943 + 261 WP_150043345.1 hypothetical protein -
NBY65_RS33465 (RHOA_PG0050) 26940..27305 + 366 WP_150043347.1 hypothetical protein -
NBY65_RS33470 (RHOA_PG0051) 27302..27496 + 195 WP_150043349.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..55472 55472


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(5-93)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(1-92)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10650.13 Da        Isoelectric Point: 8.0754

>T295429 WP_150043329.1 NZ_OW485608:c22927-22646 [Rhodovastum atsumiense]
MPIRSFRDDDTRELHLIGRNRRWAAIAKVAVRKLDMLDAAAALNDLRVPPANRLEALKGDRAGGHSIRINDQFRICFRWT
DAGPEDVEIVDYH

Download         Length: 282 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11028.72 Da        Isoelectric Point: 10.1956

>AT295429 WP_150043328.1 NZ_OW485608:c22633-22331 [Rhodovastum atsumiense]
MTKPRIRTHPGEVLLEEFMRPLALSANALARDLAVPPNRITAIINPVAPRSITPDTALRLSRYFGTTPEFWMNLQAAHDL
SKAQAESAERIAAEVQPRAA

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References