Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
Location | 2162674..2163542 | Replicon | chromosome |
Accession | NZ_OW052571 | ||
Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | higB | Uniprot ID | P9WJA4 |
Locus tag | MR179_RS10190 | Protein ID | WP_010886136.1 |
Coordinates | 2163165..2163542 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0TLM0 |
Locus tag | MR179_RS10185 | Protein ID | WP_003409886.1 |
Coordinates | 2162674..2163123 (-) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR179_RS10145 | 2158459..2159679 | + | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
MR179_RS10150 | 2159712..2159984 | + | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR179_RS10155 | 2159988..2160395 | + | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
MR179_RS10160 | 2160555..2161049 | - | 495 | WP_003899099.1 | hypothetical protein | - |
MR179_RS10165 | 2161036..2161287 | + | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
MR179_RS10170 | 2161284..2161580 | + | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
MR179_RS10175 | 2161629..2162243 | + | 615 | WP_003901296.1 | hypothetical protein | - |
MR179_RS10180 | 2162132..2162677 | - | 546 | WP_003409891.1 | SecB-like chaperone | - |
MR179_RS10185 | 2162674..2163123 | - | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
MR179_RS10190 | 2163165..2163542 | - | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
MR179_RS10195 | 2163517..2164038 | + | 522 | WP_003904745.1 | hypothetical protein | - |
MR179_RS10200 | 2164012..2164323 | - | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
MR179_RS10205 | 2164320..2164535 | - | 216 | WP_003409878.1 | antitoxin | - |
MR179_RS10210 | 2164775..2165071 | + | 297 | WP_003409877.1 | hypothetical protein | - |
MR179_RS10215 | 2165072..2165263 | + | 192 | WP_003409876.1 | hypothetical protein | - |
MR179_RS10220 | 2165284..2166186 | + | 903 | WP_031657727.1 | hypothetical protein | - |
MR179_RS10225 | 2166197..2166547 | + | 351 | WP_003899096.1 | hypothetical protein | - |
MR179_RS10230 | 2166661..2166843 | + | 183 | WP_003409870.1 | hypothetical protein | - |
MR179_RS10235 | 2166836..2167237 | - | 402 | WP_003409869.1 | hypothetical protein | - |
MR179_RS10240 | 2167301..2167753 | + | 453 | WP_003899095.1 | lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T295348 WP_010886136.1 NZ_OW052571:c2163542-2163165 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT295348 WP_003409886.1 NZ_OW052571:c2163123-2162674 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|