Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2097536..2098455 | Replicon | chromosome |
| Accession | NZ_OW052571 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | L7N4R2 |
| Locus tag | MR179_RS09815 | Protein ID | WP_003900449.1 |
| Coordinates | 2097536..2098141 (+) | Length | 202 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | L7N5K9 |
| Locus tag | MR179_RS09820 | Protein ID | WP_003410124.1 |
| Coordinates | 2098150..2098455 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR179_RS09795 | 2093512..2094510 | + | 999 | WP_003410146.1 | cation diffusion facilitator family transporter | - |
| MR179_RS09800 | 2095020..2096537 | + | 1518 | Protein_1936 | DEAD/DEAH box helicase family protein | - |
| MR179_RS09805 | 2096597..2096992 | + | 396 | WP_079156352.1 | hypothetical protein | - |
| MR179_RS09810 | 2097152..2097511 | + | 360 | WP_003410131.1 | hypothetical protein | - |
| MR179_RS09815 | 2097536..2098141 | + | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MR179_RS09820 | 2098150..2098455 | + | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
| MR179_RS09825 | 2098540..2098839 | + | 300 | WP_003410120.1 | hypothetical protein | - |
| MR179_RS09830 | 2098855..2099271 | - | 417 | WP_003410114.1 | hypothetical protein | - |
| MR179_RS09835 | 2099261..2099980 | - | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
| MR179_RS09840 | 2100222..2101262 | - | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MR179_RS09845 | 2101259..2101834 | - | 576 | WP_003410100.1 | hypothetical protein | - |
| MR179_RS09850 | 2102188..2103444 | + | 1257 | WP_003410095.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T295342 WP_003900449.1 NZ_OW052571:2097536-2098141 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BV20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7EWC | |
| PDB | 7EWD | |
| PDB | 7EWE | |
| AlphaFold DB | A0A7U4BV30 |