Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 816434..817104 | Replicon | chromosome |
| Accession | NZ_OW052571 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | O53332 |
| Locus tag | MR179_RS03655 | Protein ID | WP_003899954.1 |
| Coordinates | 816760..817104 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0THF6 |
| Locus tag | MR179_RS03650 | Protein ID | WP_003899955.1 |
| Coordinates | 816434..816763 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR179_RS03625 | 811849..812883 | + | 1035 | WP_003416786.1 | IS30 family transposase | - |
| MR179_RS03630 | 813130..813339 | - | 210 | WP_003416778.1 | hypothetical protein | - |
| MR179_RS03635 | 813507..814772 | + | 1266 | WP_003912135.1 | hypothetical protein | - |
| MR179_RS03640 | 814932..815552 | - | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
| MR179_RS03645 | 815549..815896 | - | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
| MR179_RS03650 | 816434..816763 | - | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
| MR179_RS03655 | 816760..817104 | - | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MR179_RS03660 | 817335..817787 | + | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| MR179_RS03665 | 817790..818224 | + | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR179_RS03675 | 819929..821218 | - | 1290 | WP_003416640.1 | ATP-binding protein | - |
| MR179_RS03680 | 821506..821799 | - | 294 | WP_003416635.1 | hypothetical protein | - |
| MR179_RS03685 | 821812..822023 | - | 212 | Protein_730 | (R)-hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T295324 WP_003899954.1 NZ_OW052571:c817104-816760 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FBK2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6LTY | |
| PDB | 6LTZ | |
| AlphaFold DB | G0THF6 |