Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4397342..4398261 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | - |
Locus tag | MR177_RS20485 | Protein ID | WP_242302828.1 |
Coordinates | 4397342..4397947 (+) | Length | 202 a.a. |
Antitoxin (Protein)
Gene name | HigA2 | Uniprot ID | L7N5K9 |
Locus tag | MR177_RS20490 | Protein ID | WP_003410124.1 |
Coordinates | 4397956..4398261 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS20465 | 4394830..4395726 | + | 897 | WP_003904759.1 | hypothetical protein | - |
MR177_RS20470 | 4395933..4396169 | + | 237 | WP_003410133.1 | hypothetical protein | - |
MR177_RS20475 | 4396208..4396798 | + | 591 | WP_057145698.1 | hypothetical protein | - |
MR177_RS20480 | 4396958..4397317 | + | 360 | WP_003410131.1 | hypothetical protein | - |
MR177_RS20485 | 4397342..4397947 | + | 606 | WP_242302828.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MR177_RS20490 | 4397956..4398261 | + | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
MR177_RS20495 | 4398346..4398645 | + | 300 | WP_003410120.1 | hypothetical protein | - |
MR177_RS20500 | 4398661..4399077 | - | 417 | WP_003410114.1 | hypothetical protein | - |
MR177_RS20505 | 4399067..4399786 | - | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
MR177_RS20510 | 4400028..4401068 | - | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
MR177_RS20515 | 4401065..4401640 | - | 576 | WP_003410100.1 | hypothetical protein | - |
MR177_RS20520 | 4401994..4403250 | + | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22773.01 Da Isoelectric Point: 7.3073
>T295319 WP_242302828.1 NZ_OW052570:4397342-4397947 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPVRQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPVRQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|