Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 54817..55685 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | MR177_RS00325 | Protein ID | WP_010886136.1 |
| Coordinates | 55308..55685 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | MR177_RS00320 | Protein ID | WP_003409886.1 |
| Coordinates | 54817..55266 (-) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS00280 | 50602..51822 | + | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
| MR177_RS00285 | 51855..52127 | + | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| MR177_RS00290 | 52131..52538 | + | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR177_RS00295 | 52698..53192 | - | 495 | WP_003899099.1 | hypothetical protein | - |
| MR177_RS00300 | 53179..53430 | + | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| MR177_RS00305 | 53427..53723 | + | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MR177_RS00310 | 53772..54386 | + | 615 | WP_003901296.1 | hypothetical protein | - |
| MR177_RS00315 | 54275..54820 | - | 546 | WP_003409891.1 | SecB-like chaperone | - |
| MR177_RS00320 | 54817..55266 | - | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| MR177_RS00325 | 55308..55685 | - | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| MR177_RS00330 | 55660..56181 | + | 522 | WP_003904745.1 | hypothetical protein | - |
| MR177_RS00335 | 56155..56466 | - | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR177_RS00340 | 56463..56678 | - | 216 | WP_003409878.1 | antitoxin | - |
| MR177_RS00345 | 56918..57214 | + | 297 | WP_003409877.1 | hypothetical protein | - |
| MR177_RS00350 | 57215..57406 | + | 192 | WP_003409876.1 | hypothetical protein | - |
| MR177_RS00355 | 57427..58329 | + | 903 | WP_003409874.1 | hypothetical protein | - |
| MR177_RS00360 | 58340..58690 | + | 351 | WP_003409871.1 | hypothetical protein | - |
| MR177_RS00365 | 58804..58986 | + | 183 | WP_003409870.1 | hypothetical protein | - |
| MR177_RS00370 | 58979..59380 | - | 402 | WP_003409869.1 | hypothetical protein | - |
| MR177_RS00375 | 59444..59896 | + | 453 | WP_003899095.1 | lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T295265 WP_010886136.1 NZ_OW052570:c55685-55308 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT295265 WP_003409886.1 NZ_OW052570:c55266-54817 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|