Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3198728..3199398 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | MR176_RS14745 | Protein ID | WP_003899954.1 |
Coordinates | 3199054..3199398 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | MR176_RS14740 | Protein ID | WP_003899955.1 |
Coordinates | 3198728..3199057 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS14710 | 3194143..3195177 | + | 1035 | WP_003416786.1 | IS30 family transposase | - |
MR176_RS14715 | 3195204..3195389 | - | 186 | WP_015630737.1 | hypothetical protein | - |
MR176_RS14720 | 3195424..3195633 | - | 210 | WP_003416778.1 | hypothetical protein | - |
MR176_RS14725 | 3195801..3197066 | + | 1266 | WP_003902423.1 | hypothetical protein | - |
MR176_RS14730 | 3197226..3197846 | - | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
MR176_RS14735 | 3197843..3198190 | - | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
MR176_RS14740 | 3198728..3199057 | - | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
MR176_RS14745 | 3199054..3199398 | - | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MR176_RS14750 | 3199629..3200081 | + | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR176_RS14755 | 3200084..3200518 | + | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
MR176_RS14760 | 3200865..3202154 | - | 1290 | WP_003416640.1 | ATP-binding protein | - |
MR176_RS14765 | 3202442..3202735 | - | 294 | WP_003416635.1 | hypothetical protein | - |
MR176_RS14770 | 3202748..3202959 | - | 212 | Protein_2921 | (R)-hydratase | - |
MR176_RS14775 | 3202975..3203490 | - | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
MR176_RS14780 | 3203465..3204325 | - | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T295243 WP_003899954.1 NZ_OW052302:c3199398-3199054 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6LTY | |
PDB | 6LTZ | |
AlphaFold DB | G0THF6 |