Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
Location | 120735..121603 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | higB | Uniprot ID | P9WJA4 |
Locus tag | MR176_RS00585 | Protein ID | WP_010886136.1 |
Coordinates | 121226..121603 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0TLM0 |
Locus tag | MR176_RS00580 | Protein ID | WP_003409886.1 |
Coordinates | 120735..121184 (-) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS00540 | 116520..117740 | + | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
MR176_RS00545 | 117773..118045 | + | 273 | WP_031651155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR176_RS00550 | 118049..118456 | + | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
MR176_RS00555 | 118616..119110 | - | 495 | WP_003899099.1 | hypothetical protein | - |
MR176_RS00560 | 119097..119348 | + | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
MR176_RS00565 | 119345..119641 | + | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
MR176_RS00570 | 119690..120304 | + | 615 | WP_003901296.1 | hypothetical protein | - |
MR176_RS00575 | 120193..120738 | - | 546 | WP_003409891.1 | SecB-like chaperone | - |
MR176_RS00580 | 120735..121184 | - | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
MR176_RS00585 | 121226..121603 | - | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
MR176_RS00590 | 121578..122099 | + | 522 | WP_003904745.1 | hypothetical protein | - |
MR176_RS00595 | 122073..122384 | - | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
MR176_RS00600 | 122381..122596 | - | 216 | WP_003409878.1 | antitoxin | - |
MR176_RS00605 | 122836..123132 | + | 297 | WP_003409877.1 | hypothetical protein | - |
MR176_RS00610 | 123133..123324 | + | 192 | WP_003409876.1 | hypothetical protein | - |
MR176_RS00615 | 123345..124247 | + | 903 | WP_003899097.1 | hypothetical protein | - |
MR176_RS00620 | 124258..124608 | + | 351 | WP_003409871.1 | hypothetical protein | - |
MR176_RS00625 | 124722..124904 | + | 183 | WP_003409870.1 | hypothetical protein | - |
MR176_RS00630 | 124897..125298 | - | 402 | WP_003409869.1 | hypothetical protein | - |
MR176_RS00635 | 125362..125814 | + | 453 | WP_003899095.1 | lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T295207 WP_010886136.1 NZ_OW052302:c121603-121226 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT295207 WP_003409886.1 NZ_OW052302:c121184-120735 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|