Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 51173..52092 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | L7N4R2 |
Locus tag | MR176_RS00180 | Protein ID | WP_003900449.1 |
Coordinates | 51173..51778 (+) | Length | 202 a.a. |
Antitoxin (Protein)
Gene name | HigA2 | Uniprot ID | L7N5K9 |
Locus tag | MR176_RS00185 | Protein ID | WP_003410124.1 |
Coordinates | 51787..52092 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS00160 | 48661..49557 | + | 897 | WP_003410136.1 | hypothetical protein | - |
MR176_RS00165 | 49764..50000 | + | 237 | WP_003410133.1 | hypothetical protein | - |
MR176_RS00170 | 49997..50629 | + | 633 | WP_003913310.1 | hypothetical protein | - |
MR176_RS00175 | 50789..51148 | + | 360 | WP_003410131.1 | hypothetical protein | - |
MR176_RS00180 | 51173..51778 | + | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MR176_RS00185 | 51787..52092 | + | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
MR176_RS00190 | 52177..52476 | + | 300 | WP_003410120.1 | hypothetical protein | - |
MR176_RS00195 | 52492..52908 | - | 417 | WP_003410114.1 | hypothetical protein | - |
MR176_RS00200 | 52898..53617 | - | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
MR176_RS00205 | 53859..54899 | - | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
MR176_RS00210 | 54896..55471 | - | 576 | WP_003410100.1 | hypothetical protein | - |
MR176_RS00215 | 55825..57081 | + | 1257 | WP_016720149.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T295201 WP_003900449.1 NZ_OW052302:51173-51778 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV30 |