Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 4035353..4036221 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | MR259_RS18815 | Protein ID | WP_010886136.1 |
| Coordinates | 4035353..4035730 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | MR259_RS18820 | Protein ID | WP_003409886.1 |
| Coordinates | 4035772..4036221 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS18765 | 4031142..4031594 | - | 453 | WP_003899095.1 | lipoprotein | - |
| MR259_RS18770 | 4031658..4032059 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| MR259_RS18775 | 4032052..4032234 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| MR259_RS18780 | 4032348..4032698 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| MR259_RS18785 | 4032709..4033611 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| MR259_RS18790 | 4033632..4033823 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| MR259_RS18795 | 4033824..4034120 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| MR259_RS18800 | 4034360..4034575 | + | 216 | WP_003409878.1 | antitoxin | - |
| MR259_RS18805 | 4034572..4034883 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR259_RS18810 | 4034857..4035378 | - | 522 | WP_003904745.1 | hypothetical protein | - |
| MR259_RS18815 | 4035353..4035730 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| MR259_RS18820 | 4035772..4036221 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| MR259_RS18825 | 4036218..4036763 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| MR259_RS18830 | 4036652..4037266 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| MR259_RS18835 | 4037315..4037611 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MR259_RS18840 | 4037608..4037859 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| MR259_RS18845 | 4037846..4038340 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| MR259_RS18850 | 4038500..4038907 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR259_RS18855 | 4038911..4039183 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| MR259_RS18860 | 4039216..4040436 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T295191 WP_010886136.1 NZ_OW052189:4035353-4035730 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT295191 WP_003409886.1 NZ_OW052189:4035772-4036221 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|