Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-PHD |
| Location | 1228392..1229059 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O50411 |
| Locus tag | MR259_RS05780 | Protein ID | WP_003417916.1 |
| Coordinates | 1228392..1228784 (-) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
| Locus tag | MR259_RS05785 | Protein ID | WP_003912214.1 |
| Coordinates | 1228784..1229059 (-) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS05760 | 1224239..1225228 | - | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| MR259_RS05765 | 1225228..1225617 | - | 390 | Protein_1137 | polyprenyl synthetase family protein | - |
| MR259_RS05770 | 1225670..1226931 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
| MR259_RS05775 | 1226973..1227638 | - | 666 | Protein_1139 | polyprenyl synthetase family protein | - |
| MR259_RS05780 | 1228392..1228784 | - | 393 | WP_003417916.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR259_RS05785 | 1228784..1229059 | - | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MR259_RS05790 | 1229241..1230612 | + | 1372 | Protein_1142 | ISNCY family transposase | - |
| MR259_RS05795 | 1230802..1232979 | + | 2178 | WP_016330440.1 | PE family protein | - |
| MR259_RS05800 | 1233050..1233922 | - | 873 | WP_031716378.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | IScluster/Tn | - | - | 1225670..1230612 | 4942 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14316.74 Da Isoelectric Point: 10.7249
>T295158 WP_003417916.1 NZ_OW052189:c1228784-1228392 [Mycobacterium tuberculosis]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BXS8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E8U8S7 |