Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 975219..975913 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | O53332 |
| Locus tag | MR259_RS04700 | Protein ID | WP_003899954.1 |
| Coordinates | 975219..975563 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | MR259_RS04705 | Protein ID | WP_017487555.1 |
| Coordinates | 975560..975913 (+) | Length | 118 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS04665 | 970383..970594 | + | 212 | Protein_918 | (R)-hydratase | - |
| MR259_RS04670 | 970607..970900 | + | 294 | WP_003416635.1 | hypothetical protein | - |
| MR259_RS04675 | 970966..972227 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
| MR259_RS04680 | 972546..972686 | + | 141 | Protein_921 | ATP-binding protein | - |
| MR259_RS04690 | 974099..974533 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR259_RS04695 | 974536..974988 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| MR259_RS04700 | 975219..975563 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MR259_RS04705 | 975560..975913 | + | 354 | WP_017487555.1 | XRE family transcriptional regulator | Antitoxin |
| MR259_RS04715 | 977786..978133 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
| MR259_RS04720 | 978130..978750 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
| MR259_RS04725 | 978910..980175 | - | 1266 | WP_003902423.1 | hypothetical protein | - |
| MR259_RS04730 | 980343..980552 | + | 210 | WP_003416778.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 970966..995077 | 24111 | |
| - | inside | IScluster/Tn | - | - | 970966..977179 | 6213 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T295155 WP_003899954.1 NZ_OW052189:975219-975563 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Download Length: 118 a.a. Molecular weight: 12613.32 Da Isoelectric Point: 7.4053
>AT295155 WP_017487555.1 NZ_OW052189:975560-975913 [Mycobacterium tuberculosis]
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVVNRPGESGDSLI
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVVNRPGESGDSLI
Download Length: 354 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|