Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
Location | 3688385..3689253 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | higB | Uniprot ID | P9WJA4 |
Locus tag | MR221_RS17325 | Protein ID | WP_010886136.1 |
Coordinates | 3688876..3689253 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0TLM0 |
Locus tag | MR221_RS17320 | Protein ID | WP_003409886.1 |
Coordinates | 3688385..3688834 (-) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS17280 | 3684170..3685390 | + | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
MR221_RS17285 | 3685423..3685695 | + | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR221_RS17290 | 3685699..3686106 | + | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
MR221_RS17295 | 3686266..3686760 | - | 495 | WP_003899099.1 | hypothetical protein | - |
MR221_RS17300 | 3686747..3686998 | + | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
MR221_RS17305 | 3686995..3687291 | + | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
MR221_RS17310 | 3687340..3687954 | + | 615 | WP_003901296.1 | hypothetical protein | - |
MR221_RS17315 | 3687843..3688388 | - | 546 | WP_003409891.1 | SecB-like chaperone | - |
MR221_RS17320 | 3688385..3688834 | - | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
MR221_RS17325 | 3688876..3689253 | - | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
MR221_RS17330 | 3689228..3689749 | + | 522 | WP_003904745.1 | hypothetical protein | - |
MR221_RS17335 | 3689723..3690034 | - | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
MR221_RS17340 | 3690031..3690246 | - | 216 | WP_003409878.1 | antitoxin | - |
MR221_RS17345 | 3690486..3690782 | + | 297 | WP_003409877.1 | hypothetical protein | - |
MR221_RS17350 | 3690783..3690974 | + | 192 | WP_003409876.1 | hypothetical protein | - |
MR221_RS17355 | 3690995..3691897 | + | 903 | WP_003409874.1 | hypothetical protein | - |
MR221_RS17360 | 3691908..3692258 | + | 351 | WP_242363164.1 | hypothetical protein | - |
MR221_RS17365 | 3692372..3692554 | + | 183 | WP_003409870.1 | hypothetical protein | - |
MR221_RS17370 | 3692547..3692948 | - | 402 | WP_003409869.1 | hypothetical protein | - |
MR221_RS17375 | 3693012..3693464 | + | 453 | WP_003899095.1 | lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T295133 WP_010886136.1 NZ_OW052188:c3689253-3688876 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT295133 WP_003409886.1 NZ_OW052188:c3688834-3688385 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|