Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3618749..3619668 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | L7N4R2 |
Locus tag | MR221_RS16920 | Protein ID | WP_003900449.1 |
Coordinates | 3618749..3619354 (+) | Length | 202 a.a. |
Antitoxin (Protein)
Gene name | HigA2 | Uniprot ID | L7N5K9 |
Locus tag | MR221_RS16925 | Protein ID | WP_003410124.1 |
Coordinates | 3619363..3619668 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS16900 | 3616237..3617133 | + | 897 | WP_242363159.1 | hypothetical protein | - |
MR221_RS16905 | 3617340..3617576 | + | 237 | WP_003410133.1 | hypothetical protein | - |
MR221_RS16910 | 3617615..3618205 | + | 591 | WP_057145698.1 | hypothetical protein | - |
MR221_RS16915 | 3618365..3618724 | + | 360 | WP_003410131.1 | hypothetical protein | - |
MR221_RS16920 | 3618749..3619354 | + | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MR221_RS16925 | 3619363..3619668 | + | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
MR221_RS16930 | 3619753..3620052 | + | 300 | WP_003410120.1 | hypothetical protein | - |
MR221_RS16935 | 3620068..3620484 | - | 417 | WP_003410114.1 | hypothetical protein | - |
MR221_RS16940 | 3620474..3621193 | - | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
MR221_RS16945 | 3621435..3622475 | - | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
MR221_RS16950 | 3622472..3623047 | - | 576 | WP_003410100.1 | hypothetical protein | - |
MR221_RS16955 | 3623401..3624657 | + | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T295127 WP_003900449.1 NZ_OW052188:3618749-3619354 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV30 |