Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2339880..2340550 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | MR221_RS10825 | Protein ID | WP_003899954.1 |
Coordinates | 2340206..2340550 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | MR221_RS10820 | Protein ID | WP_242363115.1 |
Coordinates | 2339880..2340209 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS10790 | 2335295..2336329 | + | 1035 | WP_003905011.1 | IS30 family transposase | - |
MR221_RS10795 | 2336356..2336541 | - | 186 | WP_003908177.1 | hypothetical protein | - |
MR221_RS10800 | 2336576..2336785 | - | 210 | WP_003416778.1 | hypothetical protein | - |
MR221_RS10805 | 2336953..2338218 | + | 1266 | WP_003909837.1 | hypothetical protein | - |
MR221_RS10810 | 2338378..2338998 | - | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
MR221_RS10815 | 2338995..2339342 | - | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
MR221_RS10820 | 2339880..2340209 | - | 330 | WP_242363115.1 | XRE family transcriptional regulator | Antitoxin |
MR221_RS10825 | 2340206..2340550 | - | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MR221_RS10830 | 2340781..2341233 | + | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR221_RS10835 | 2341236..2341670 | + | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
MR221_RS10840 | 2342017..2343306 | - | 1290 | WP_003416640.1 | ATP-binding protein | - |
MR221_RS10845 | 2343594..2343887 | - | 294 | WP_003416635.1 | hypothetical protein | - |
MR221_RS10850 | 2343900..2344111 | - | 212 | Protein_2144 | (R)-hydratase | - |
MR221_RS10855 | 2344127..2344642 | - | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
MR221_RS10860 | 2344617..2345477 | - | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T295110 WP_003899954.1 NZ_OW052188:c2340550-2340206 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|