Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 331629..332215 Replicon chromosome
Accession NZ_OV753987
Organism Klebsiella pneumoniae isolate BB1542

Toxin (Protein)


Gene name doc Uniprot ID A0A483YV82
Locus tag O0552_RS01545 Protein ID WP_019725145.1
Coordinates 331847..332215 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A483YZZ9
Locus tag O0552_RS01540 Protein ID WP_019725146.1
Coordinates 331629..331850 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O0552_RS01520 (VKR_00300) 327786..328712 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
O0552_RS01525 (VKR_00301) 328709..329986 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
O0552_RS01530 (VKR_00302) 329983..330750 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
O0552_RS01535 (VKR_00303) 330752..331465 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
O0552_RS01540 (VKR_00304) 331629..331850 + 222 WP_019725146.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
O0552_RS01545 (VKR_00305) 331847..332215 + 369 WP_019725145.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
O0552_RS01550 (VKR_00306) 332487..333803 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
O0552_RS01555 (VKR_00307) 333910..334797 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
O0552_RS01560 (VKR_00308) 334794..335639 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
O0552_RS01565 (VKR_00309) 335641..336711 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 328709..337448 8739


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13542.89 Da        Isoelectric Point: 8.6410

>T295038 WP_019725145.1 NZ_OV753987:331847-332215 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFIKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT295038 WP_019725146.1 NZ_OV753987:331629-331850 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A483YV82

Antitoxin

Source ID Structure
AlphaFold DB A0A483YZZ9

References