Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2383427..2383611 | Replicon | chromosome |
| Accession | NZ_OV648025 | ||
| Organism | Staphylococcus argenteus isolate 20S00001-1_long | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | MD993_RS11415 | Protein ID | WP_000482653.1 |
| Coordinates | 2383504..2383611 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2383427..2383487 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MD993_RS11405 | 2379279..2381012 | - | 1734 | WP_031787186.1 | ABC transporter ATP-binding protein | - |
| MD993_RS11410 | 2381037..2382800 | - | 1764 | WP_031787187.1 | ABC transporter ATP-binding protein | - |
| - | 2383427..2383487 | + | 61 | - | - | Antitoxin |
| MD993_RS11415 | 2383504..2383611 | - | 108 | WP_000482653.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| MD993_RS11420 | 2383745..2384131 | - | 387 | WP_000779346.1 | flippase GtxA | - |
| MD993_RS11425 | 2384399..2385541 | + | 1143 | WP_031787188.1 | glycerate kinase | - |
| MD993_RS11430 | 2385600..2386259 | + | 660 | WP_000831306.1 | membrane protein | - |
| MD993_RS11435 | 2386444..2387655 | + | 1212 | WP_031787189.1 | multidrug effflux MFS transporter | - |
| MD993_RS11440 | 2387771..2388250 | - | 480 | WP_031787190.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sbi / hlgA / hlgA / hlgC / hlgB | 2368066..2384131 | 16065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4025.81 Da Isoelectric Point: 11.0582
>T295025 WP_000482653.1 NZ_OV648025:c2383611-2383504 [Staphylococcus argenteus]
MFNLLINIMTTAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTTAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT295025 NZ_OV648025:2383427-2383487 [Staphylococcus argenteus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|