Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 2357977..2358494 | Replicon | chromosome |
Accession | NZ_OV648025 | ||
Organism | Staphylococcus argenteus isolate 20S00001-1_long |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A7U7PWL3 |
Locus tag | MD993_RS11295 | Protein ID | WP_031787172.1 |
Coordinates | 2357977..2358243 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A7U7PWU0 |
Locus tag | MD993_RS11300 | Protein ID | WP_031787173.1 |
Coordinates | 2358243..2358494 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MD993_RS11270 | 2353407..2353943 | - | 537 | WP_031787169.1 | GNAT family N-acetyltransferase | - |
MD993_RS11275 | 2354176..2355000 | - | 825 | WP_000572040.1 | formate/nitrite transporter family protein | - |
MD993_RS11280 | 2355217..2355402 | - | 186 | WP_000230291.1 | hypothetical protein | - |
MD993_RS11285 | 2355486..2355953 | - | 468 | WP_031787170.1 | SRPBCC domain-containing protein | - |
MD993_RS11290 | 2356136..2357680 | - | 1545 | WP_031787171.1 | zinc ABC transporter substrate-binding lipoprotein AdcA | - |
MD993_RS11295 | 2357977..2358243 | - | 267 | WP_031787172.1 | Txe/YoeB family addiction module toxin | Toxin |
MD993_RS11300 | 2358243..2358494 | - | 252 | WP_031787173.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MD993_RS11305 | 2358766..2359365 | - | 600 | WP_000162802.1 | DsbA family protein | - |
MD993_RS11310 | 2359385..2359747 | - | 363 | WP_031787174.1 | DUF4467 domain-containing protein | - |
MD993_RS11315 | 2360001..2361251 | + | 1251 | WP_031787175.1 | aminoacyltransferase | - |
MD993_RS11320 | 2361346..2362077 | - | 732 | WP_000615469.1 | amino acid ABC transporter ATP-binding protein | - |
MD993_RS11325 | 2362074..2362793 | - | 720 | WP_000479573.1 | amino acid ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10511.99 Da Isoelectric Point: 9.7791
>T295024 WP_031787172.1 NZ_OV648025:c2358243-2357977 [Staphylococcus argenteus]
MARLNITFSPQAFEDYEYFQQNDKKMVKKINELLKSIDRNGALQGIGKPEKLKSNLFGYYSRRINHEHRLVYTVDDNHIK
IASCRYHY
MARLNITFSPQAFEDYEYFQQNDKKMVKKINELLKSIDRNGALQGIGKPEKLKSNLFGYYSRRINHEHRLVYTVDDNHIK
IASCRYHY
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U7PWL3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U7PWU0 |