Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2486005..2486694 | Replicon | chromosome |
Accession | NZ_OV408202 | ||
Organism | Klebsiella pneumoniae isolate CNR146C9 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | NBX86_RS12125 | Protein ID | WP_021469727.1 |
Coordinates | 2486005..2486322 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | NBX86_RS12130 | Protein ID | WP_020804705.1 |
Coordinates | 2486398..2486694 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBX86_RS12095 (2481707) | 2481707..2482216 | + | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
NBX86_RS12100 (2482226) | 2482226..2483152 | + | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
NBX86_RS12105 (2483136) | 2483136..2483915 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
NBX86_RS12110 (2483954) | 2483954..2484805 | + | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
NBX86_RS12115 (2484883) | 2484883..2485500 | + | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
NBX86_RS12120 (2485571) | 2485571..2485798 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
NBX86_RS12125 (2486005) | 2486005..2486322 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBX86_RS12130 (2486398) | 2486398..2486694 | + | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
NBX86_RS12135 (2486773) | 2486773..2487219 | + | 447 | WP_032435212.1 | hypothetical protein | - |
NBX86_RS12140 (2487260) | 2487260..2488876 | - | 1617 | WP_004175961.1 | carbohydrate porin | - |
NBX86_RS12145 (2488920) | 2488920..2490302 | - | 1383 | WP_004151222.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T295010 WP_021469727.1 NZ_OV408202:2486005-2486322 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |