Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-YefM
Location 197710..198212 Replicon chromosome
Accession NZ_OV350343
Organism Halomonas sp. TD01 strain Halomonas Bluephagenesis

Toxin (Protein)


Gene name yoeB Uniprot ID F7SL02
Locus tag L1X57_RS00950 Protein ID WP_009722423.1
Coordinates 197710..197973 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID F7SL01
Locus tag L1X57_RS00955 Protein ID WP_009722422.1
Coordinates 197970..198212 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L1X57_RS00930 (HPTD01_177) 193758..194480 + 723 WP_009722427.1 CDP-alcohol phosphatidyltransferase family protein -
L1X57_RS00935 (HPTD01_178) 194812..196464 + 1653 WP_009722426.1 sodium:solute symporter family protein -
L1X57_RS00940 (HPTD01_179) 196537..196668 + 132 WP_009722425.1 putative transporter small subunit -
L1X57_RS00945 (HPTD01_180) 196753..197574 + 822 WP_009722424.1 aldo/keto reductase -
L1X57_RS00950 (HPTD01_181) 197710..197973 - 264 WP_009722423.1 Txe/YoeB family addiction module toxin Toxin
L1X57_RS00955 (HPTD01_182) 197970..198212 - 243 WP_009722422.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
L1X57_RS00960 (HPTD01_183) 198377..198835 - 459 WP_009722421.1 hypothetical protein -
L1X57_RS00965 (HPTD01_184) 199001..200017 - 1017 WP_234667734.1 IS30 family transposase -
L1X57_RS00970 (HPTD01_185) 200264..200734 - 471 WP_009722419.1 GNAT family N-acetyltransferase -
L1X57_RS00975 (HPTD01_186) 200847..201266 - 420 WP_143759711.1 hypothetical protein -
L1X57_RS00980 (HPTD01_187) 201491..201703 - 213 WP_050801085.1 transposase -
L1X57_RS00985 (HPTD01_188) 201684..201932 - 249 WP_234667860.1 transposase -
L1X57_RS00990 (HPTD01_189) 202096..202707 - 612 WP_009722417.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(7-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-68)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10092.66 Da        Isoelectric Point: 9.3425

>T294998 WP_009722423.1 NZ_OV350343:c197973-197710 [Halomonas sp. TD01]
VTWTLVYTKQAQKDAEKLASSGLKPKAQELLALIAEDPYRKPPPFEKLIGDLTGAYSRRINIQHRLVYQVLEDEQVVKVL
RLWSHYE

Download         Length: 264 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9075.15 Da        Isoelectric Point: 4.0066

>AT294998 WP_009722422.1 NZ_OV350343:c198212-197970 [Halomonas sp. TD01]
MTGITATEARSNLYRLIDETAESHQPIVIMGKRNKAVLVSEEDWSAIQETLYLLSVPGMRESIREGMDTSVDECDEELDW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB F7SL02

Antitoxin

Source ID Structure
AlphaFold DB A0A1S2DG95

References