Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2519007..2519593 Replicon chromosome
Accession NZ_OV049808
Organism Klebsiella pneumoniae strain DJ isolate DJ

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag LRA90_RS12035 Protein ID WP_002920800.1
Coordinates 2519225..2519593 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag LRA90_RS12030 Protein ID WP_004174006.1
Coordinates 2519007..2519228 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LRA90_RS12010 (2515164) 2515164..2516090 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
LRA90_RS12015 (2516087) 2516087..2517364 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
LRA90_RS12020 (2517361) 2517361..2518128 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
LRA90_RS12025 (2518130) 2518130..2518843 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
LRA90_RS12030 (2519007) 2519007..2519228 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LRA90_RS12035 (2519225) 2519225..2519593 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LRA90_RS12040 (2519866) 2519866..2521182 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
LRA90_RS12045 (2521289) 2521289..2522176 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
LRA90_RS12050 (2522173) 2522173..2523018 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
LRA90_RS12055 (2523020) 2523020..2524090 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2516087..2524827 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T294979 WP_002920800.1 NZ_OV049808:2519225-2519593 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT294979 WP_004174006.1 NZ_OV049808:2519007-2519228 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References