Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1569295..1569934 | Replicon | chromosome |
Accession | NZ_OV040719 | ||
Organism | Haemophilus influenzae strain 3655 isolate 3655 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q4QJX7 |
Locus tag | LSO74_RS07980 | Protein ID | WP_005650215.1 |
Coordinates | 1569629..1569934 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LSO74_RS07975 | Protein ID | WP_005650217.1 |
Coordinates | 1569295..1569618 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LSO74_RS07955 (KRLU3655_LOCUS1509) | 1564914..1565087 | - | 174 | WP_005657572.1 | DUF5363 domain-containing protein | - |
LSO74_RS07960 (KRLU3655_LOCUS1510) | 1565084..1567054 | - | 1971 | WP_005657574.1 | GNAT family N-acetyltransferase | - |
LSO74_RS07965 (KRLU3655_LOCUS1511) | 1567059..1567400 | - | 342 | WP_005657576.1 | SirB2 family protein | - |
LSO74_RS07970 (KRLU3655_LOCUS1512) | 1567462..1569132 | - | 1671 | WP_005657578.1 | energy-dependent translational throttle protein EttA | - |
LSO74_RS07975 (KRLU3655_LOCUS1513) | 1569295..1569618 | - | 324 | WP_005650217.1 | HigA family addiction module antitoxin | Antitoxin |
LSO74_RS07980 (KRLU3655_LOCUS1514) | 1569629..1569934 | - | 306 | WP_005650215.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LSO74_RS07985 (KRLU3655_LOCUS1515) | 1570259..1570879 | + | 621 | WP_005657580.1 | zinc transporter binding subunit ZevA | - |
LSO74_RS07990 (KRLU3655_LOCUS1516) | 1570882..1571850 | + | 969 | WP_005657582.1 | zinc transporter permease subunit ZevB | - |
LSO74_RS08000 (KRLU3655_LOCUS1517) | 1572466..1574505 | + | 2040 | WP_005646675.1 | excinuclease ABC subunit UvrB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12301.93 Da Isoelectric Point: 9.0853
>T294973 WP_005650215.1 NZ_OV040719:c1569934-1569629 [Haemophilus influenzae]
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|