Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4651249..4652003 Replicon chromosome
Accession NZ_OU943338
Organism Salmonella enterica subsp. enterica serovar Typhi strain MDUST348

Toxin (Protein)


Gene name higB Uniprot ID Q8Z2U0
Locus tag AFF66_RS23045 Protein ID WP_000558160.1
Coordinates 4651249..4651560 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag AFF66_RS23050 Protein ID WP_001259009.1
Coordinates 4651557..4652003 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AFF66_RS23015 (SAMEA2158835_04595) 4646915..4647817 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
AFF66_RS23020 (SAMEA2158835_04596) 4647814..4648449 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
AFF66_RS23025 (SAMEA2158835_04597) 4648446..4649375 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
AFF66_RS23030 (SAMEA2158835_04598) 4649413..4649787 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin -
AFF66_RS23035 (SAMEA2158835_04599) 4649787..4650029 - 243 WP_001523745.1 CopG family transcriptional regulator -
AFF66_RS23040 (SAMEA2158835_04600) 4650234..4651163 + 930 WP_001162859.1 alpha/beta hydrolase -
AFF66_RS23045 (SAMEA2158835_04601) 4651249..4651560 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin Toxin
AFF66_RS23050 (SAMEA2158835_04602) 4651557..4652003 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
AFF66_RS23055 (SAMEA2158835_04603) 4652018..4652959 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
AFF66_RS23060 (SAMEA2158835_04604) 4653004..4653441 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
AFF66_RS23065 (SAMEA2158835_04605) 4653438..4654310 - 873 WP_000921423.1 virulence factor BrkB family protein -
AFF66_RS23070 (SAMEA2158835_04606) 4654304..4654903 - 600 WP_000965695.1 glucose-1-phosphatase -
AFF66_RS23075 (SAMEA2158835_04607) 4655094..4655897 - 804 WP_000059689.1 DeoR family transcriptional regulator -
AFF66_RS23080 (SAMEA2158835_04608) 4655931..4656827 - 897 WP_001520529.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12449.38 Da        Isoelectric Point: 8.4020

>T294949 WP_000558160.1 NZ_OU943338:4651249-4651560 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT294949 WP_001259009.1 NZ_OU943338:4651557-4652003 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A714FUZ5

Antitoxin

Source ID Structure

References