Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4697639..4698393 Replicon chromosome
Accession NZ_OU943337
Organism Salmonella enterica subsp. enterica serovar Typhi strain MDUST255

Toxin (Protein)


Gene name higB Uniprot ID Q8Z2U0
Locus tag AE465_RS23160 Protein ID WP_000558160.1
Coordinates 4697639..4697950 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag AE465_RS23165 Protein ID WP_001259009.1
Coordinates 4697947..4698393 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AE465_RS23130 (SAMEA2145578_04645) 4693305..4694207 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
AE465_RS23135 (SAMEA2145578_04646) 4694204..4694839 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
AE465_RS23140 (SAMEA2145578_04647) 4694836..4695765 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
AE465_RS23145 (SAMEA2145578_04648) 4695803..4696177 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin -
AE465_RS23150 (SAMEA2145578_04649) 4696177..4696419 - 243 WP_001523745.1 CopG family transcriptional regulator -
AE465_RS23155 (SAMEA2145578_04650) 4696624..4697553 + 930 WP_001162859.1 alpha/beta hydrolase -
AE465_RS23160 (SAMEA2145578_04651) 4697639..4697950 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin Toxin
AE465_RS23165 (SAMEA2145578_04652) 4697947..4698393 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
AE465_RS23170 (SAMEA2145578_04653) 4698408..4699349 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
AE465_RS23175 (SAMEA2145578_04654) 4699394..4699831 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
AE465_RS23180 (SAMEA2145578_04655) 4699828..4700700 - 873 WP_000921423.1 virulence factor BrkB family protein -
AE465_RS23185 (SAMEA2145578_04656) 4700694..4701293 - 600 WP_000965695.1 glucose-1-phosphatase -
AE465_RS23190 (SAMEA2145578_04657) 4701484..4702287 - 804 WP_000059689.1 DeoR family transcriptional regulator -
AE465_RS23195 (SAMEA2145578_04658) 4702321..4703217 - 897 WP_001520529.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12449.38 Da        Isoelectric Point: 8.4020

>T294934 WP_000558160.1 NZ_OU943337:4697639-4697950 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT294934 WP_001259009.1 NZ_OU943337:4697947-4698393 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A714FUZ5

Antitoxin

Source ID Structure

References