Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4519948..4520702 Replicon chromosome
Accession NZ_OU943336
Organism Salmonella enterica subsp. enterica serovar Typhi strain MDUST305

Toxin (Protein)


Gene name higB Uniprot ID Q8Z2U0
Locus tag AEG13_RS22295 Protein ID WP_000558160.1
Coordinates 4519948..4520259 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag AEG13_RS22300 Protein ID WP_001259009.1
Coordinates 4520256..4520702 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AEG13_RS22265 (SAMEA1964467_04457) 4515614..4516516 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
AEG13_RS22270 (SAMEA1964467_04458) 4516513..4517148 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
AEG13_RS22275 (SAMEA1964467_04459) 4517145..4518074 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
AEG13_RS22280 (SAMEA1964467_04460) 4518112..4518486 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin -
AEG13_RS22285 (SAMEA1964467_04461) 4518486..4518728 - 243 WP_001523745.1 CopG family transcriptional regulator -
AEG13_RS22290 (SAMEA1964467_04462) 4518933..4519862 + 930 WP_001162859.1 alpha/beta hydrolase -
AEG13_RS22295 (SAMEA1964467_04463) 4519948..4520259 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin Toxin
AEG13_RS22300 (SAMEA1964467_04464) 4520256..4520702 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
AEG13_RS22305 (SAMEA1964467_04465) 4520717..4521658 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
AEG13_RS22310 (SAMEA1964467_04466) 4521703..4522140 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
AEG13_RS22315 (SAMEA1964467_04467) 4522137..4523009 - 873 WP_000921423.1 virulence factor BrkB family protein -
AEG13_RS22320 (SAMEA1964467_04468) 4523003..4523602 - 600 WP_000965695.1 glucose-1-phosphatase -
AEG13_RS22325 (SAMEA1964467_04469) 4523793..4524596 - 804 WP_000059689.1 DeoR family transcriptional regulator -
AEG13_RS22330 (SAMEA1964467_04470) 4524630..4525526 - 897 WP_001520529.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12449.38 Da        Isoelectric Point: 8.4020

>T294919 WP_000558160.1 NZ_OU943336:4519948-4520259 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT294919 WP_001259009.1 NZ_OU943336:4520256-4520702 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A714FUZ5

Antitoxin

Source ID Structure

References