Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 585321..585910 | Replicon | chromosome |
Accession | NZ_OU912926 | ||
Organism | Candidatus Nitrotoga arctica strain 6680 isolate 6680 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | MKZ32_RS02770 | Protein ID | WP_239795869.1 |
Coordinates | 585321..585596 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | MKZ32_RS02775 | Protein ID | WP_239795870.1 |
Coordinates | 585605..585910 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKZ32_RS02755 (NTG6680_0563) | 581250..582314 | + | 1065 | WP_239795866.1 | glycolate oxidase subunit GlcE | - |
MKZ32_RS02760 (NTG6680_0564) | 582320..583564 | + | 1245 | WP_239795867.1 | glycolate oxidase subunit GlcF | - |
MKZ32_RS02765 (NTG6680_0565) | 583759..584940 | + | 1182 | WP_239795868.1 | alanine--glyoxylate aminotransferase family protein | - |
MKZ32_RS02770 (NTG6680_0566) | 585321..585596 | + | 276 | WP_239795869.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MKZ32_RS02775 (NTG6680_0567) | 585605..585910 | + | 306 | WP_239795870.1 | HigA family addiction module antitoxin | Antitoxin |
MKZ32_RS15365 | 586032..586166 | + | 135 | WP_275584242.1 | hypothetical protein | - |
MKZ32_RS02780 (NTG6680_0568) | 586335..586526 | + | 192 | WP_239795871.1 | hypothetical protein | - |
MKZ32_RS02785 (NTG6680_0569) | 586553..586969 | + | 417 | WP_239795872.1 | hypothetical protein | - |
MKZ32_RS02790 (NTG6680_0570) | 587140..587532 | - | 393 | WP_239795873.1 | hypothetical protein | - |
MKZ32_RS02795 (NTG6680_0571) | 587590..587886 | - | 297 | WP_239795874.1 | hypothetical protein | - |
MKZ32_RS02800 (NTG6680_0572) | 588052..588438 | - | 387 | WP_275584311.1 | hypothetical protein | - |
MKZ32_RS02805 (NTG6680_0573) | 588382..588726 | + | 345 | WP_239795876.1 | hypothetical protein | - |
MKZ32_RS02810 (NTG6680_0576) | 589116..589802 | + | 687 | WP_239795877.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10580.14 Da Isoelectric Point: 8.6126
>T294899 WP_239795869.1 NZ_OU912926:585321-585596 [Candidatus Nitrotoga arctica]
MIESFMHKGLEELFEKGKSAKVQQALVGRALRRLDAINTAKTPDVLNLPGFDFHLLQGTPKRYSVHVNRPWFITFEWEGE
NALRINLENYH
MIESFMHKGLEELFEKGKSAKVQQALVGRALRRLDAINTAKTPDVLNLPGFDFHLLQGTPKRYSVHVNRPWFITFEWEGE
NALRINLENYH
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|