Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 319307..319953 | Replicon | chromosome |
Accession | NZ_OU907312 | ||
Organism | Unidentified bacterial endosymbiont isolate unidentified_bacterial_endosymbiont_Chironomus_riparius |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NL324_RS01615 | Protein ID | WP_253306058.1 |
Coordinates | 319307..319657 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NL324_RS01620 | Protein ID | WP_253306059.1 |
Coordinates | 319654..319953 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL324_RS01590 | 314628..314957 | + | 330 | WP_253306054.1 | thioredoxin TrxA | - |
NL324_RS01595 | 315165..315377 | + | 213 | WP_253306055.1 | hypothetical protein | - |
NL324_RS01600 | 315611..316879 | + | 1269 | WP_253306056.1 | transcription termination factor Rho | - |
NL324_RS01605 | 316907..318010 | - | 1104 | WP_253306057.1 | tRNA (uridine(54)-C5)-methyltransferase TrmA | - |
NL324_RS01610 | 318007..318954 | - | 948 | WP_253307096.1 | TDT family transporter | - |
NL324_RS01615 | 319307..319657 | + | 351 | WP_253306058.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL324_RS01620 | 319654..319953 | + | 300 | WP_253306059.1 | XRE family transcriptional regulator | Antitoxin |
NL324_RS01625 | 320075..321013 | - | 939 | WP_253307079.1 | IS3 family transposase | - |
NL324_RS01630 | 320941..321240 | - | 300 | WP_253305847.1 | transposase | - |
NL324_RS01635 | 321347..322297 | - | 951 | WP_253306060.1 | methionyl-tRNA formyltransferase | - |
NL324_RS01640 | 322297..322821 | - | 525 | WP_253306061.1 | peptide deformylase | - |
NL324_RS01645 | 322969..324102 | + | 1134 | WP_253306062.1 | DNA-processing protein DprA | - |
NL324_RS01650 | 324074..324547 | + | 474 | WP_253306063.1 | DUF494 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 277675..341035 | 63360 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13520.47 Da Isoelectric Point: 9.6250
>T294890 WP_253306058.1 NZ_OU907312:319307-319657 [unidentified bacterial endosymbiont]
MWTVVLTPRFYAWLHEQENGMQEKVLANLTNLETYGPKLSRPYADTVKGSRHKNMKELRVQYSGSPIRAFFAFDHERQAI
VLCAGYKSNNKRFYETMLRIADEEFTAHLSGMEGKK
MWTVVLTPRFYAWLHEQENGMQEKVLANLTNLETYGPKLSRPYADTVKGSRHKNMKELRVQYSGSPIRAFFAFDHERQAI
VLCAGYKSNNKRFYETMLRIADEEFTAHLSGMEGKK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|