Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1323762..1324373 | Replicon | chromosome |
| Accession | NZ_OU745373 | ||
| Organism | Cardiobacterium sp. Marseille-Q4385 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | LG374_RS06460 | Protein ID | WP_225756922.1 |
| Coordinates | 1324191..1324373 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LG374_RS06450 | Protein ID | WP_225756921.1 |
| Coordinates | 1323762..1324079 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LG374_RS06435 | 1320103..1320411 | + | 309 | WP_225756322.1 | IS630 transposase-related protein | - |
| LG374_RS06440 | 1320432..1320935 | + | 504 | WP_255594586.1 | IS630 family transposase | - |
| LG374_RS06445 | 1321063..1323669 | - | 2607 | WP_225756920.1 | leucine--tRNA ligase | - |
| LG374_RS06450 | 1323762..1324079 | - | 318 | WP_225756921.1 | HigA family addiction module antitoxin | Antitoxin |
| LG374_RS06455 | 1324094..1324153 | - | 60 | WP_225758005.1 | hypothetical protein | - |
| LG374_RS06460 | 1324191..1324373 | - | 183 | WP_225756922.1 | hypothetical protein | Toxin |
| LG374_RS06465 | 1324540..1325514 | + | 975 | WP_225756923.1 | thiosulfate ABC transporter substrate-binding protein CysP | - |
| LG374_RS06470 | 1325584..1326555 | - | 972 | WP_225756924.1 | HemK family protein methyltransferase | - |
| LG374_RS06475 | 1326622..1327416 | + | 795 | WP_225756925.1 | VacJ family lipoprotein | - |
| LG374_RS06480 | 1327400..1328344 | + | 945 | WP_225756926.1 | ribosome small subunit-dependent GTPase A | - |
| LG374_RS06485 | 1328341..1328607 | + | 267 | WP_225756927.1 | exodeoxyribonuclease VII small subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6564.68 Da Isoelectric Point: 10.1490
>T294884 WP_225756922.1 NZ_OU745373:c1324373-1324191 [Cardiobacterium sp. Marseille-Q4385]
MIKSFASKETKAFFAGDMVKRYQAFAAAAERKLTLLDEAKALDDLKIPMGNKLEALRGGS
MIKSFASKETKAFFAGDMVKRYQAFAAAAERKLTLLDEAKALDDLKIPMGNKLEALRGGS
Download Length: 183 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11791.69 Da Isoelectric Point: 6.7260
>AT294884 WP_225756921.1 NZ_OU745373:c1324079-1323762 [Cardiobacterium sp. Marseille-Q4385]
MMTKNGMRPIHPGEILREEYLAPLGLSVNALALALRVPATRMHAIVKEERSITPDTALRLARYFGTTPELWLSLQSTYDI
KIAMQSFRPEEVLPFAETQHAAETA
MMTKNGMRPIHPGEILREEYLAPLGLSVNALALALRVPATRMHAIVKEERSITPDTALRLARYFGTTPELWLSLQSTYDI
KIAMQSFRPEEVLPFAETQHAAETA
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|