Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4493753..4494355 | Replicon | chromosome |
Accession | NZ_OU701452 | ||
Organism | Escherichia coli isolate CNR65D6 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | LWS60_RS21655 | Protein ID | WP_000897305.1 |
Coordinates | 4493753..4494064 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LWS60_RS21660 | Protein ID | WP_000356395.1 |
Coordinates | 4494065..4494355 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LWS60_RS21630 (4488795) | 4488795..4489232 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
LWS60_RS21635 (4489277) | 4489277..4490218 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
LWS60_RS21640 (4490634) | 4490634..4491521 | + | 888 | Protein_4233 | hypothetical protein | - |
LWS60_RS21645 (4491534) | 4491534..4492448 | + | 915 | WP_109553727.1 | transposase | - |
LWS60_RS21650 (4492616) | 4492616..4493524 | - | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
LWS60_RS21655 (4493753) | 4493753..4494064 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
LWS60_RS21660 (4494065) | 4494065..4494355 | + | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
LWS60_RS21665 (4494440) | 4494440..4494661 | + | 222 | WP_001550354.1 | hypothetical protein | - |
LWS60_RS21670 (4494713) | 4494713..4494991 | + | 279 | WP_001315112.1 | hypothetical protein | - |
LWS60_RS21675 (4495410) | 4495410..4495628 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
LWS60_RS21680 (4495847) | 4495847..4496089 | + | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
LWS60_RS21685 (4496271) | 4496271..4497200 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
LWS60_RS21690 (4497197) | 4497197..4497832 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
LWS60_RS21695 (4497829) | 4497829..4498731 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T294878 WP_000897305.1 NZ_OU701452:4493753-4494064 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|