Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3661891..3662690 | Replicon | chromosome |
| Accession | NZ_OU701452 | ||
| Organism | Escherichia coli isolate CNR65D6 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F0JQM9 |
| Locus tag | LWS60_RS17680 | Protein ID | WP_000347270.1 |
| Coordinates | 3662226..3662690 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A0V9H1L4 |
| Locus tag | LWS60_RS17675 | Protein ID | WP_001551693.1 |
| Coordinates | 3661891..3662226 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS60_RS17660 (3657676) | 3657676..3658446 | - | 771 | WP_001551692.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| LWS60_RS17665 (3658462) | 3658462..3659796 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| LWS60_RS17670 (3660171) | 3660171..3661742 | + | 1572 | WP_001273738.1 | galactarate dehydratase | - |
| LWS60_RS17675 (3661891) | 3661891..3662226 | + | 336 | WP_001551693.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| LWS60_RS17680 (3662226) | 3662226..3662690 | + | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| LWS60_RS17685 (3662745) | 3662745..3663554 | - | 810 | WP_106106567.1 | aga operon transcriptional regulator AgaR | - |
| LWS60_RS17690 (3663803) | 3663803..3665083 | + | 1281 | WP_001551694.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| LWS60_RS17695 (3665106) | 3665106..3665579 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| LWS60_RS17700 (3665590) | 3665590..3666369 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| LWS60_RS17705 (3666359) | 3666359..3667237 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| LWS60_RS17710 (3667255) | 3667255..3667689 | + | 435 | WP_000948837.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3653129..3662690 | 9561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T294876 WP_000347270.1 NZ_OU701452:3662226-3662690 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9NQ90 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9H1L4 |