Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3553683..3554376 | Replicon | chromosome |
| Accession | NZ_OU701452 | ||
| Organism | Escherichia coli isolate CNR65D6 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | LWS60_RS17155 | Protein ID | WP_000415583.1 |
| Coordinates | 3554080..3554376 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | LWS60_RS17150 | Protein ID | WP_000650107.1 |
| Coordinates | 3553683..3554078 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS60_RS17140 (3549547) | 3549547..3551805 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
| LWS60_RS17145 (3551943) | 3551943..3553550 | - | 1608 | WP_106106577.1 | ABC transporter substrate-binding protein | - |
| LWS60_RS17150 (3553683) | 3553683..3554078 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| LWS60_RS17155 (3554080) | 3554080..3554376 | - | 297 | WP_000415583.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| LWS60_RS17160 (3554581) | 3554581..3555063 | - | 483 | WP_106106578.1 | GyrI-like domain-containing protein | - |
| LWS60_RS17165 (3555116) | 3555116..3555508 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| LWS60_RS17170 (3555660) | 3555660..3556319 | + | 660 | WP_106106579.1 | quorum sensing response regulator transcription factor QseB | - |
| LWS60_RS17175 (3556316) | 3556316..3557665 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| LWS60_RS17180 (3557711) | 3557711..3558043 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
| LWS60_RS17185 (3558362) | 3558362..3558943 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| LWS60_RS17190 (3558974) | 3558974..3559288 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11216.99 Da Isoelectric Point: 8.9070
>T294875 WP_000415583.1 NZ_OU701452:c3554376-3554080 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGLV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGLV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT294875 WP_000650107.1 NZ_OU701452:c3554078-3553683 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|