Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 1478475..1478846 | Replicon | chromosome |
| Accession | NZ_OU701452 | ||
| Organism | Escherichia coli isolate CNR65D6 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | LWS60_RS07000 | Protein ID | WP_001317028.1 |
| Coordinates | 1478652..1478846 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 1478475..1478653 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS60_RS25065 (1474227) | 1474227..1474400 | + | 174 | WP_001296046.1 | protein YnaL | - |
| LWS60_RS06975 (1474430) | 1474430..1475803 | + | 1374 | WP_001551034.1 | ATP-dependent RNA helicase DbpA | - |
| LWS60_RS06980 (1475932) | 1475932..1476867 | - | 936 | WP_000662472.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| LWS60_RS06985 (1476919) | 1476919..1478154 | - | 1236 | WP_001551035.1 | site-specific integrase | - |
| LWS60_RS06990 (1478156) | 1478156..1478371 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (1478475) | 1478475..1478653 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1478475) | 1478475..1478653 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1478475) | 1478475..1478653 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (1478475) | 1478475..1478653 | + | 179 | NuclAT_0 | - | Antitoxin |
| LWS60_RS06995 (1478471) | 1478471..1478659 | - | 189 | WP_001551036.1 | DUF1187 family protein | - |
| LWS60_RS07000 (1478652) | 1478652..1478846 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| LWS60_RS07005 (1478903) | 1478903..1479712 | - | 810 | WP_001551037.1 | recombination protein RecT | - |
| LWS60_RS07010 (1479705) | 1479705..1482356 | - | 2652 | WP_001551038.1 | exodeoxyribonuclease VIII | - |
| LWS60_RS07015 (1482458) | 1482458..1482733 | - | 276 | WP_001314664.1 | hypothetical protein | - |
| LWS60_RS07020 (1482808) | 1482808..1482978 | - | 171 | WP_001551041.1 | YdaE family protein | - |
| LWS60_RS07025 (1482978) | 1482978..1483199 | - | 222 | WP_000560221.1 | killing protein KilR | - |
| LWS60_RS07030 (1483620) | 1483620..1483772 | - | 153 | WP_001551042.1 | DUF1391 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1476919..1524209 | 47290 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T294861 WP_001317028.1 NZ_OU701452:c1478846-1478652 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT294861 NZ_OU701452:1478475-1478653 [Escherichia coli]
GAGGACTGAAGTCTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGGCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTCTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGGCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
