Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 284608..285302 | Replicon | chromosome |
| Accession | NZ_OU701452 | ||
| Organism | Escherichia coli isolate CNR65D6 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | LWS60_RS01295 | Protein ID | WP_001263491.1 |
| Coordinates | 284904..285302 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | LWS60_RS01290 | Protein ID | WP_000554755.1 |
| Coordinates | 284608..284901 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS60_RS01265 (280229) | 280229..280585 | - | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| LWS60_RS01270 (280578) | 280578..280856 | - | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| LWS60_RS01275 (280961) | 280961..282673 | - | 1713 | Protein_247 | flagellar biosynthesis protein FlhA | - |
| LWS60_RS01280 (282645) | 282645..283430 | + | 786 | WP_019842510.1 | putative lateral flagellar export/assembly protein LafU | - |
| LWS60_RS01285 (283501) | 283501..284556 | + | 1056 | WP_001550655.1 | DNA polymerase IV | - |
| LWS60_RS01290 (284608) | 284608..284901 | + | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| LWS60_RS01295 (284904) | 284904..285302 | + | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| LWS60_RS01300 (285312) | 285312..285764 | + | 453 | WP_019842500.1 | GNAT family N-acetyltransferase | - |
| LWS60_RS01305 (286010) | 286010..286216 | + | 207 | Protein_253 | RtcB family protein | - |
| LWS60_RS01310 (286212) | 286212..286564 | + | 353 | Protein_254 | peptide chain release factor H | - |
| LWS60_RS01315 (286621) | 286621..288078 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| LWS60_RS01320 (288339) | 288339..288797 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (289393) | 289393..289473 | + | 81 | NuclAT_9 | - | - |
| - (289393) | 289393..289473 | + | 81 | NuclAT_9 | - | - |
| - (289393) | 289393..289473 | + | 81 | NuclAT_9 | - | - |
| - (289393) | 289393..289473 | + | 81 | NuclAT_9 | - | - |
| LWS60_RS01325 (288889) | 288889..290133 | + | 1245 | WP_000189541.1 | esterase FrsA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T294853 WP_001263491.1 NZ_OU701452:284904-285302 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |