Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 284608..285302 Replicon chromosome
Accession NZ_OU701452
Organism Escherichia coli isolate CNR65D6

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag LWS60_RS01295 Protein ID WP_001263491.1
Coordinates 284904..285302 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag LWS60_RS01290 Protein ID WP_000554755.1
Coordinates 284608..284901 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LWS60_RS01265 (280229) 280229..280585 - 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -
LWS60_RS01270 (280578) 280578..280856 - 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
LWS60_RS01275 (280961) 280961..282673 - 1713 Protein_247 flagellar biosynthesis protein FlhA -
LWS60_RS01280 (282645) 282645..283430 + 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
LWS60_RS01285 (283501) 283501..284556 + 1056 WP_001550655.1 DNA polymerase IV -
LWS60_RS01290 (284608) 284608..284901 + 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
LWS60_RS01295 (284904) 284904..285302 + 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
LWS60_RS01300 (285312) 285312..285764 + 453 WP_019842500.1 GNAT family N-acetyltransferase -
LWS60_RS01305 (286010) 286010..286216 + 207 Protein_253 RtcB family protein -
LWS60_RS01310 (286212) 286212..286564 + 353 Protein_254 peptide chain release factor H -
LWS60_RS01315 (286621) 286621..288078 - 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
LWS60_RS01320 (288339) 288339..288797 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (289393) 289393..289473 + 81 NuclAT_9 - -
- (289393) 289393..289473 + 81 NuclAT_9 - -
- (289393) 289393..289473 + 81 NuclAT_9 - -
- (289393) 289393..289473 + 81 NuclAT_9 - -
LWS60_RS01325 (288889) 288889..290133 + 1245 WP_000189541.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T294853 WP_001263491.1 NZ_OU701452:284904-285302 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT294853 WP_000554755.1 NZ_OU701452:284608-284901 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References