Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4002035..4002729 Replicon chromosome
Accession NZ_OU701449
Organism Escherichia coli isolate CNR85I8

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag LWS57_RS19305 Protein ID WP_001263491.1
Coordinates 4002035..4002433 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag LWS57_RS19310 Protein ID WP_000554755.1
Coordinates 4002436..4002729 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3997864) 3997864..3997944 - 81 NuclAT_10 - -
- (3997864) 3997864..3997944 - 81 NuclAT_10 - -
- (3997864) 3997864..3997944 - 81 NuclAT_10 - -
- (3997864) 3997864..3997944 - 81 NuclAT_10 - -
LWS57_RS19275 (3997204) 3997204..3998448 - 1245 WP_000189541.1 esterase FrsA -
LWS57_RS19280 (3998540) 3998540..3998998 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
LWS57_RS19285 (3999259) 3999259..4000716 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
LWS57_RS19290 (4000773) 4000773..4001125 - 353 Protein_3791 peptide chain release factor H -
LWS57_RS19295 (4001121) 4001121..4001327 - 207 Protein_3792 RtcB family protein -
LWS57_RS19300 (4001573) 4001573..4002025 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
LWS57_RS19305 (4002035) 4002035..4002433 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
LWS57_RS19310 (4002436) 4002436..4002729 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
LWS57_RS19315 (4002781) 4002781..4003836 - 1056 WP_001550655.1 DNA polymerase IV -
LWS57_RS19320 (4003907) 4003907..4004692 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
LWS57_RS19325 (4004664) 4004664..4006376 + 1713 Protein_3798 flagellar biosynthesis protein FlhA -
LWS57_RS19330 (4006481) 4006481..4006759 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
LWS57_RS19335 (4006752) 4006752..4007108 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3991971..4002729 10758


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T294848 WP_001263491.1 NZ_OU701449:c4002433-4002035 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT294848 WP_000554755.1 NZ_OU701449:c4002729-4002436 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References