Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1211527..1212254 | Replicon | chromosome |
| Accession | NZ_OU701449 | ||
| Organism | Escherichia coli isolate CNR85I8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | LWS57_RS05870 | Protein ID | WP_000547555.1 |
| Coordinates | 1211527..1211838 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LWS57_RS05875 | Protein ID | WP_000126294.1 |
| Coordinates | 1211835..1212254 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS57_RS05845 (1207462) | 1207462..1209171 | + | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
| LWS57_RS05850 (1209181) | 1209181..1209723 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| LWS57_RS05855 (1209723) | 1209723..1210490 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| LWS57_RS05860 (1210487) | 1210487..1210897 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| LWS57_RS05865 (1210890) | 1210890..1211360 | + | 471 | WP_001551542.1 | hydrogenase maturation peptidase HycI | - |
| LWS57_RS05870 (1211527) | 1211527..1211838 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| LWS57_RS05875 (1211835) | 1211835..1212254 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| LWS57_RS05880 (1212333) | 1212333..1213757 | - | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
| LWS57_RS05885 (1213766) | 1213766..1215223 | - | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| LWS57_RS05890 (1215483) | 1215483..1216493 | + | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
| LWS57_RS05895 (1216642) | 1216642..1217169 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T294837 WP_000547555.1 NZ_OU701449:1211527-1211838 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT294837 WP_000126294.1 NZ_OU701449:1211835-1212254 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|