Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 737468..738161 | Replicon | chromosome |
| Accession | NZ_OU701449 | ||
| Organism | Escherichia coli isolate CNR85I8 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | LWS57_RS03545 | Protein ID | WP_000415583.1 |
| Coordinates | 737468..737764 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | LWS57_RS03550 | Protein ID | WP_000650107.1 |
| Coordinates | 737766..738161 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LWS57_RS03510 (732556) | 732556..732870 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| LWS57_RS03515 (732901) | 732901..733482 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| LWS57_RS03520 (733801) | 733801..734133 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| LWS57_RS03525 (734179) | 734179..735528 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| LWS57_RS03530 (735525) | 735525..736184 | - | 660 | WP_106106579.1 | quorum sensing response regulator transcription factor QseB | - |
| LWS57_RS03535 (736336) | 736336..736728 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| LWS57_RS03540 (736781) | 736781..737263 | + | 483 | WP_106106578.1 | GyrI-like domain-containing protein | - |
| LWS57_RS03545 (737468) | 737468..737764 | + | 297 | WP_000415583.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| LWS57_RS03550 (737766) | 737766..738161 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| LWS57_RS03555 (738294) | 738294..739901 | + | 1608 | WP_106106577.1 | ABC transporter substrate-binding protein | - |
| LWS57_RS03560 (740039) | 740039..742297 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11216.99 Da Isoelectric Point: 8.9070
>T294833 WP_000415583.1 NZ_OU701449:737468-737764 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGLV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGLV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT294833 WP_000650107.1 NZ_OU701449:737766-738161 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|