Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 629154..629953 | Replicon | chromosome |
Accession | NZ_OU701449 | ||
Organism | Escherichia coli isolate CNR85I8 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F0JQM9 |
Locus tag | LWS57_RS03020 | Protein ID | WP_000347270.1 |
Coordinates | 629154..629618 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | A0A0V9H1L4 |
Locus tag | LWS57_RS03025 | Protein ID | WP_001551693.1 |
Coordinates | 629618..629953 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LWS57_RS02990 (624155) | 624155..624589 | - | 435 | WP_000948837.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
LWS57_RS02995 (624607) | 624607..625485 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LWS57_RS03000 (625475) | 625475..626254 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LWS57_RS03005 (626265) | 626265..626738 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LWS57_RS03010 (626761) | 626761..628041 | - | 1281 | WP_001551694.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LWS57_RS03015 (628290) | 628290..629099 | + | 810 | WP_106106567.1 | aga operon transcriptional regulator AgaR | - |
LWS57_RS03020 (629154) | 629154..629618 | - | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LWS57_RS03025 (629618) | 629618..629953 | - | 336 | WP_001551693.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LWS57_RS03030 (630102) | 630102..631673 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
LWS57_RS03035 (632048) | 632048..633382 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
LWS57_RS03040 (633398) | 633398..634168 | + | 771 | WP_001551692.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T294832 WP_000347270.1 NZ_OU701449:c629618-629154 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9NQ90 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9H1L4 |