Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 540072..540658 | Replicon | chromosome |
| Accession | NZ_OU659204 | ||
| Organism | Providencia alcalifaciens strain 2019-04-29291-1-1 isolate 2019-04-29291-1-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | LDO73_RS02340 | Protein ID | WP_282560819.1 |
| Coordinates | 540072..540362 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LDO73_RS02345 | Protein ID | WP_224060024.1 |
| Coordinates | 540359..540658 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDO73_RS02320 (NVI2019_GHJFPKLH_00465) | 535845..537401 | + | 1557 | WP_282560818.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| LDO73_RS02325 (NVI2019_GHJFPKLH_00466) | 537500..538396 | + | 897 | WP_036955277.1 | transporter | - |
| LDO73_RS02330 (NVI2019_GHJFPKLH_00467) | 538448..539101 | - | 654 | WP_224060021.1 | RES family NAD+ phosphorylase | - |
| LDO73_RS02335 (NVI2019_GHJFPKLH_00468) | 539064..539804 | - | 741 | WP_282560733.1 | hypothetical protein | - |
| LDO73_RS02340 (NVI2019_GHJFPKLH_00469) | 540072..540362 | + | 291 | WP_282560819.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LDO73_RS02345 (NVI2019_GHJFPKLH_00470) | 540359..540658 | + | 300 | WP_224060024.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| LDO73_RS02350 (NVI2019_GHJFPKLH_00471) | 540734..541741 | - | 1008 | WP_224060025.1 | AraC family transcriptional regulator | - |
| LDO73_RS02355 (NVI2019_GHJFPKLH_00472) | 542431..544656 | + | 2226 | WP_224060026.1 | indolepyruvate ferredoxin oxidoreductase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11039.76 Da Isoelectric Point: 9.8549
>T294820 WP_282560819.1 NZ_OU659204:540072-540362 [Providencia alcalifaciens]
MQEKVFASLGNLEVYGPKLSRPYADTIKGSQYPNMKELRVQHMGKPIRAFFAFDPKRQAIVLCAGDKSNDKKFYSKMIRI
ADDEFSKYLASIEDKQ
MQEKVFASLGNLEVYGPKLSRPYADTIKGSQYPNMKELRVQHMGKPIRAFFAFDPKRQAIVLCAGDKSNDKKFYSKMIRI
ADDEFSKYLASIEDKQ
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|