Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 52708..53300 | Replicon | plasmid 2 |
Accession | NZ_OU659163 | ||
Organism | Providencia alcalifaciens strain 2019-04-29292-1-3 isolate 2019-04-29292-1-3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | LDO74_RS19470 | Protein ID | WP_036978105.1 |
Coordinates | 53022..53300 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LDO74_RS19465 | Protein ID | WP_036978107.1 |
Coordinates | 52708..53022 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LDO74_RS19445 | 47964..49105 | + | 1142 | Protein_27 | IS256 family transposase | - |
LDO74_RS19455 (NVI2019_OGMBKCAO_03910) | 50518..51462 | - | 945 | WP_282565831.1 | conjugal transfer protein TraH | - |
LDO74_RS21090 (NVI2019_OGMBKCAO_03912) | 51474..51626 | - | 153 | WP_263428478.1 | conjugal transfer protein TraH | - |
LDO74_RS19465 (NVI2019_OGMBKCAO_03913) | 52708..53022 | - | 315 | WP_036978107.1 | HigA family addiction module antitoxin | Antitoxin |
LDO74_RS19470 (NVI2019_OGMBKCAO_03914) | 53022..53300 | - | 279 | WP_036978105.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LDO74_RS19485 | 53828..54109 | - | 282 | WP_036978103.1 | hypothetical protein | - |
LDO74_RS19490 (NVI2019_OGMBKCAO_03916) | 54141..54674 | - | 534 | WP_282563841.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
LDO74_RS19495 (NVI2019_OGMBKCAO_03917) | 54617..54913 | - | 297 | WP_282563840.1 | hypothetical protein | - |
LDO74_RS19500 (NVI2019_OGMBKCAO_03918) | 54883..55734 | - | 852 | WP_282563862.1 | conjugal transfer protein TraN | - |
LDO74_RS19505 (NVI2019_OGMBKCAO_03919) | 55924..56751 | - | 828 | WP_051420221.1 | hypothetical protein | - |
LDO74_RS19510 (NVI2019_OGMBKCAO_03920) | 56733..57368 | - | 636 | WP_282563847.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cdtC / cdtB / cdtB / cdtA / yopJ/yopP / stcE / exeG / prgK / prgI / sicA / spaS / spaQ / spaP / invC/sctN / invA | 1..171398 | 171398 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10868.34 Da Isoelectric Point: 8.4391
>T294814 WP_036978105.1 NZ_OU659163:c53300-53022 [Providencia alcalifaciens]
MIKSFKHKGLKQLFEKGITSGVPAQDAERINDRLQAIDIANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
MIKSFKHKGLKQLFEKGITSGVPAQDAERINDRLQAIDIANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|