Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 146913..147505 | Replicon | plasmid 2 |
| Accession | NZ_OU659121 | ||
| Organism | Providencia alcalifaciens strain 2019-04-28369-1-2 isolate 2019-04-28369-1-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | LDO76_RS19995 | Protein ID | WP_036978105.1 |
| Coordinates | 146913..147191 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LDO76_RS20000 | Protein ID | WP_036978107.1 |
| Coordinates | 147191..147505 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDO76_RS19960 (NVI2019_PLFLNFOB_04009) | 142845..143480 | + | 636 | WP_282563847.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
| LDO76_RS19965 (NVI2019_PLFLNFOB_04010) | 143462..144289 | + | 828 | WP_051420221.1 | hypothetical protein | - |
| LDO76_RS19970 (NVI2019_PLFLNFOB_04011) | 144479..145330 | + | 852 | WP_282563862.1 | conjugal transfer protein TraN | - |
| LDO76_RS19975 (NVI2019_PLFLNFOB_04012) | 145300..145596 | + | 297 | WP_282563840.1 | hypothetical protein | - |
| LDO76_RS19980 (NVI2019_PLFLNFOB_04013) | 145539..146072 | + | 534 | WP_282563841.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
| LDO76_RS19985 | 146104..146385 | + | 282 | WP_036978103.1 | hypothetical protein | - |
| LDO76_RS19995 (NVI2019_PLFLNFOB_04015) | 146913..147191 | + | 279 | WP_036978105.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LDO76_RS20000 (NVI2019_PLFLNFOB_04016) | 147191..147505 | + | 315 | WP_036978107.1 | HigA family addiction module antitoxin | Antitoxin |
| LDO76_RS20010 (NVI2019_PLFLNFOB_04019) | 148587..149695 | + | 1109 | Protein_138 | conjugal transfer protein TraH | - |
| LDO76_RS20020 | 151108..152249 | - | 1142 | Protein_139 | IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cdtA / cdtB / cdtB / cdtC / invA / invC/sctN / spaP / spaQ / spaS / sicA / prgI / prgK / exeG / stcE / yopJ/yopP | 1..171405 | 171405 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10868.34 Da Isoelectric Point: 8.4391
>T294790 WP_036978105.1 NZ_OU659121:146913-147191 [Providencia alcalifaciens]
MIKSFKHKGLKQLFEKGITSGVPAQDAERINDRLQAIDIANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
MIKSFKHKGLKQLFEKGITSGVPAQDAERINDRLQAIDIANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|