Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 65538..66130 | Replicon | plasmid 2 |
| Accession | NZ_OU659119 | ||
| Organism | Providencia alcalifaciens strain 2019-01-3283-1-1 isolate 2019-01-3283-1-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | LDO75_RS18815 | Protein ID | WP_036978105.1 |
| Coordinates | 65538..65816 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LDO75_RS18820 | Protein ID | WP_036978107.1 |
| Coordinates | 65816..66130 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDO75_RS18785 (NVI2019_PEGOAJLN_03776) | 61387..62022 | + | 636 | WP_282563847.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
| LDO75_RS18790 (NVI2019_PEGOAJLN_03777) | 62004..62831 | + | 828 | WP_224063863.1 | hypothetical protein | - |
| LDO75_RS18795 (NVI2019_PEGOAJLN_03778) | 63021..63872 | + | 852 | WP_282564491.1 | conjugal transfer protein TraN | - |
| LDO75_RS18800 (NVI2019_PEGOAJLN_03779) | 63842..64615 | + | 774 | WP_224063865.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
| LDO75_RS18805 (NVI2019_PEGOAJLN_03780) | 64647..64928 | + | 282 | WP_224063867.1 | hypothetical protein | - |
| LDO75_RS18815 (NVI2019_PEGOAJLN_03782) | 65538..65816 | + | 279 | WP_036978105.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LDO75_RS18820 (NVI2019_PEGOAJLN_03783) | 65816..66130 | + | 315 | WP_036978107.1 | HigA family addiction module antitoxin | Antitoxin |
| LDO75_RS18825 (NVI2019_PEGOAJLN_03785) | 67055..68431 | + | 1377 | Protein_70 | conjugal transfer pilus assembly protein TraH | - |
| LDO75_RS18830 (NVI2019_PEGOAJLN_03786) | 68454..68675 | + | 222 | WP_282564486.1 | hypothetical protein | - |
| LDO75_RS18835 (NVI2019_PEGOAJLN_03787) | 68696..69010 | + | 315 | WP_224063869.1 | hypothetical protein | - |
| LDO75_RS18840 (NVI2019_PEGOAJLN_03788) | 69969..70454 | + | 486 | WP_282564487.1 | ProQ/FINO family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | yopJ/yopP / stcE / exeG / cdtB / cdtB / cdtC / invA / invC/sctN / spaP / spaQ / spaS / sicA / prgI / prgK | 1..168972 | 168972 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10868.34 Da Isoelectric Point: 8.4391
>T294786 WP_036978105.1 NZ_OU659119:65538-65816 [Providencia alcalifaciens]
MIKSFKHKGLKQLFEKGITSGVPAQDAERINDRLQAIDIANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
MIKSFKHKGLKQLFEKGITSGVPAQDAERINDRLQAIDIANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|