Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 146164..146756 | Replicon | plasmid 2 |
Accession | NZ_OU659114 | ||
Organism | Providencia alcalifaciens strain 2019-04-27799-1-2 isolate 2019-04-27799-1-2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | LDO34_RS19980 | Protein ID | WP_036978105.1 |
Coordinates | 146164..146442 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LDO34_RS19985 | Protein ID | WP_036978107.1 |
Coordinates | 146442..146756 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LDO34_RS19945 (NVI2019_KOLGMIGM_04011) | 142096..142731 | + | 636 | WP_282563847.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
LDO34_RS19950 (NVI2019_KOLGMIGM_04012) | 142713..143540 | + | 828 | WP_051420221.1 | hypothetical protein | - |
LDO34_RS19955 (NVI2019_KOLGMIGM_04013) | 143730..144581 | + | 852 | WP_282563862.1 | conjugal transfer protein TraN | - |
LDO34_RS19960 (NVI2019_KOLGMIGM_04014) | 144551..144847 | + | 297 | WP_282563840.1 | hypothetical protein | - |
LDO34_RS19965 (NVI2019_KOLGMIGM_04015) | 144790..145323 | + | 534 | WP_282563841.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
LDO34_RS19970 | 145355..145636 | + | 282 | WP_036978103.1 | hypothetical protein | - |
LDO34_RS19980 (NVI2019_KOLGMIGM_04017) | 146164..146442 | + | 279 | WP_036978105.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LDO34_RS19985 (NVI2019_KOLGMIGM_04018) | 146442..146756 | + | 315 | WP_036978107.1 | HigA family addiction module antitoxin | Antitoxin |
LDO34_RS19995 (NVI2019_KOLGMIGM_04021) | 147838..148946 | + | 1109 | Protein_139 | conjugal transfer protein TraH | - |
LDO34_RS20005 | 150359..151500 | - | 1142 | Protein_140 | IS256 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cdtA / cdtB / cdtB / cdtC / invA / invC/sctN / spaP / spaQ / spaS / sicA / prgI / prgK / exeG / stcE / yopJ/yopP | 1..170656 | 170656 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10868.34 Da Isoelectric Point: 8.4391
>T294778 WP_036978105.1 NZ_OU659114:146164-146442 [Providencia alcalifaciens]
MIKSFKHKGLKQLFEKGITSGVPAQDAERINDRLQAIDIANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
MIKSFKHKGLKQLFEKGITSGVPAQDAERINDRLQAIDIANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|