Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 374295..374941 | Replicon | chromosome |
| Accession | NZ_OU453210 | ||
| Organism | Klebsiella pneumoniae isolate Klebsiella pneumoniae | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A4S7KZ03 |
| Locus tag | K3775_RS01755 | Protein ID | WP_032433636.1 |
| Coordinates | 374295..374642 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A4S7L580 |
| Locus tag | K3775_RS01760 | Protein ID | WP_019725405.1 |
| Coordinates | 374642..374941 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K3775_RS01745 (370221) | 370221..371654 | + | 1434 | WP_032433640.1 | glycogen synthase GlgA | - |
| K3775_RS01750 (371672) | 371672..374119 | + | 2448 | WP_032433638.1 | glycogen phosphorylase | - |
| K3775_RS01755 (374295) | 374295..374642 | + | 348 | WP_032433636.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| K3775_RS01760 (374642) | 374642..374941 | + | 300 | WP_019725405.1 | XRE family transcriptional regulator | Antitoxin |
| K3775_RS01765 (375004) | 375004..376512 | - | 1509 | WP_029602548.1 | glycerol-3-phosphate dehydrogenase | - |
| K3775_RS01770 (376717) | 376717..377046 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| K3775_RS01775 (377097) | 377097..377927 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| K3775_RS01780 (377977) | 377977..378735 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13500.51 Da Isoelectric Point: 6.2327
>T294757 WP_032433636.1 NZ_OU453210:374295-374642 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S7KZ03 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S7L580 |