Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 348108..348694 Replicon chromosome
Accession NZ_OU453210
Organism Klebsiella pneumoniae isolate Klebsiella pneumoniae

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag K3775_RS01645 Protein ID WP_002920800.1
Coordinates 348326..348694 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag K3775_RS01640 Protein ID WP_004174006.1
Coordinates 348108..348329 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K3775_RS01620 (344265) 344265..345191 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
K3775_RS01625 (345188) 345188..346465 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
K3775_RS01630 (346462) 346462..347229 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
K3775_RS01635 (347231) 347231..347944 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
K3775_RS01640 (348108) 348108..348329 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
K3775_RS01645 (348326) 348326..348694 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
K3775_RS01650 (348967) 348967..350283 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
K3775_RS01655 (350390) 350390..351277 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
K3775_RS01660 (351274) 351274..352119 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
K3775_RS01665 (352121) 352121..353191 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 345188..353928 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T294756 WP_002920800.1 NZ_OU453210:348326-348694 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT294756 WP_004174006.1 NZ_OU453210:348108-348329 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References